Dashboard

From SME Server
Revision as of 18:45, 12 November 2014 by RequestedDeletion (talk | contribs) (edit)
Jump to navigation Jump to search

This is an overview of recently fixed and closed issues on core SME Server. Please see the most recent activities on bugzilla.

IDProductVersionPackageSummary (127 tasks)
12686SME Server 11.Xunspecifiede-smith-ibaysconvert CPU usage to Net::LDAP [smeserver-ibay]
12668SME Server 11.Xunspecifiedsmeserver-updatednf-makecache.service logs output
12653SME Server 10.X10.1smeserver-yummissing fws gpg key
12650SME Server 10.X10.1smeserver-qpsmtpdwrong syntax in /var/service/qpsmtpd/config/tls_protocol template
12647SME Server 11.Xunspecifiede-smith-backupdar fails on compressed backup request
12637SME Server 11.Xunspecifiedsmeserver-updatedebuglevel=-2 not allowed
12635SME Server 11.Xunspecifiede-smith-LPRngmove to full systemdsupport
12633SME Server 11.Xunspecifiedsmeserver-updateRuntimeError: dictionary changed size during iteration
12631SME Server 11.Xunspecifiedsmeserver-updateAttributeError: 'RPMTransactionItemWrapper' object has no attribute 'installed'
12630SME Server 11.Xunspecifiedsmeserver-sambaSamba "domain logons" and "encrypt passwords" options are deprecated
12628SME Server 11.Xunspecifiedrp-pppoemissing rp-pppoe
12627SME Server 11.Xunspecifiede-smith-baseperipheral dummy is missing
12624SME Server 11.Xunspecifiede-smith-radiusdserviceControl: Couldn't system( /usr/bin/systemctl start radiusd.service): No such file or directory
12623SME Server 11.Xunspecifiede-smith-radiusdmissing dictionnaries templates
12622SME Server 11.Xunspecifiede-smith-basemissing ppp
12621SME Server 11.Xunspecifiedsmeserver-phpremaining template expand for deprecated php
12620SME Server 11.Xunspecifiede-smith-email/var/lock -> ../run/lock
12614SME Server 11.Xunspecifiede-smith-ibayswrong path for /etc/e-smith/events/S06store-ldap-smbpasswd
12613SME Server 10.X10.1e-smith-ibayswrong path for /etc/e-smith/events/S06store-ldap-smbpasswd
12612SME Server 11.Xunspecifiede-smith-opensshe-smith-bg[3804667]: unknown key type rsa1
12610SME Server 11.Xunspecifiede-smith-ldapCorrectly disable slapd in smeserver-ldap
12606SME Server 11.Xunspecifiede-smith-baseself signed certificate keeps being regenerated
12605SME Server 11.Xunspecified---MySQL ERROR: Cannot create output file //var/lib/mysql.private/set.password.973 No such file or directory
12602SME Server 11.Xunspecifiedsmeserver-updateInternal Server Error
12601SME Server 11.Xunspecifiedsmeserver-updateAttributeError: 'RPMTransactionItemWrapper' object has no attribute 'po'
12593SME Server 11.Xunspecifiedsmeserver-hordemysql.init[681775]: Loading horde.mysql_set_password into mysql [ÉCHOUÉ]
12591SME Server 11.Xunspecifiedsmeserver-mysqladd user to dump
12590SME Server 11.Xunspecifiede-smith-ntperror on ntp update
12589SME Server 11.Xunspecifiedsmeserver-dovecot/usr/sbin/portrelease missing
12584SME Server 11.Xunspecifiede-smith-radiusd/usr/lib/tmpfiles.d/radius.conf
12583SME Server 11.Xunspecifiedsmeserver-qpsmtpdqpsmtpd line 54 /usr/local/bin/softlimit: No such file or directory
12581SME Server 11.Xunspecifiede-smith-sambaNo SID return on LDAP Modify
12577SME Server 11.Xunspecified---Make sure license document in the git repo is the correct license
12574SME Server 10.X10.1spamassassinUpgrade spamasassin to 4.0.1
12571SME Server 11.Xunspecifiedsmeserver-dovecotdovecot.conf errors
12570SME Server 11.Xunspecifiede-smith-ldapldap.init service fails on startup
12564SME Server 11.Xunspecified---sshd Deprecated option UsePrivilegeSeparation
12558SME Server 11.Xunspecifiedsmeserver-supportsmeserver-support has yum related files
12557SME Server 11.Xunspecifiede-smith-packetfilterulogd fails to start
12556SME Server 11.Xunspecifiede-smith-apachehttpd-e-smith fails to start
12555SME Server 11.Xunspecifiede-smith-managerhttpd-admin fails to start
12554SME Server 11.Xunspecifiedsmeserver-mysqllogrotate[431564]: ALERT exited abnormally with [1]
12553SME Server 11.Xunspecifiede-smith-opensshsshd fails to start /sbin/e-smith/systemd/sshd-prepare fails RSA1
12551SME Server 11.Xunspecifiede-smith-baseCan't load /proc/rtc into RNG to generate self signed cert
12550SME Server 11.Xunspecifiedsmeserver-phpno template found php55->71
12549SME Server 11.Xunspecifiedsmeserver-updateMigrating existing database yum_repositories: 4 errors
12548SME Server 11.Xunspecifiedsmeserver-dovecotmigrate//dovecot: Program fragment delivered error
12547SME Server 11.Xunspecifiede-smith-baselogrotate[431564]: ALERT exited abnormally with [1]
12546SME Server 11.Xunspecifiede-smith-basefailed to fix user group /etc/e-smith/events/post-install/S05init-accounts
12545SME Server 11.Xunspecifiede-smith-base/usr/sbin/rsyslogd: invalid option -- 'c'
12544SME Server 11.Xunspecifiede-smith-basemissing rsyslog
12543SME Server 11.Xunspecifiede-smith-baserework /etc/e-smith/events/actions/systemd-default
12541SME Server 11.Xunspecifiede-smith-basenetwork-scripts needs initscripts
12539SME Server 11.Xunspecifiedsmeserver-manager-jqueryscriptlet: smeserver-manager-jsquery
12538SME Server 11.Xunspecifiedulogdulogd : No such file or directory
12537SME Server 11.Xunspecifiede-smith-emailscriptlet error during first install
12535SME Server 11.Xunspecifiedsmeserver-qpsmtpdmove /etc/yum/post-actions/qpsmtpd to /etc/dnf/plugins/post-transaction-actions.d/qpsmtpd.action
12534SME Server 11.Xunspecifiede-smith-packetfiltermove /etc/yum/post-actions/ulogd.action to /etc/dnf/plugins/post-transaction-actions.d/
12533SME Server 11.Xunspecifiedsmeserver-clamavmove /etc/yum/post-actions/clamd.action to /etc/dnf/plugins/post-transaction-actions.d/
12528SME Server 11.Xunspecifiedsmeserver-updatechange yum-cron to an alternative
12527SME Server 11.Xunspecifiedsmeserver-updatednf plugins availables
12526SME Server 11.Xunspecifiede-smith-radiusdchange confirugration from radiusclient-ng to freeradius-client
12525SME Server 11.Xunspecifiede-smith-ntpntp deprecated
12524SME Server 11.Xunspecifiedsmeserver-mysqlremove smeserver-mariadb* packages for rh-sclo
12523SME Server 11.Xunspecifiedsmeserver-supportdrop prelink support
12522SME Server 11.Xunspecifiedsmeserver-supportdrop dmraid support
12518SME Server 11.Xunspecifiedmultiple-packagesmassive rebuild of smeserver-* core rpm
12514SME Server 10.X10.1smeserver-phpPHP 8.3 logs to 8.2 logdir
12512SME Server 11.Xunspecifieddaemontoolsdaemontools fails to build on el8
12511SME Server 11.Xunspecifiedsmeserver-yumbrp python compile fails with python3
12510SME Server 11.Xunspecifiede-smith-ldapdrop rssh support smeserver-ldap
12509SME Server 11.Xunspecifiede-smith-basedrop rssh support in smeserver-base
12501SME Server 11.Xunspecifiede-smith-devtoolsmissing pod2test deps
12462SME Server 10.X10.1e-smith-sambaNo SID return on LDAP Modify
12450SME Server 10.X10.1qpsmtpdpatch auth_imap to disable it per port as auth_cvm
12449SME Server 10.X10.1smeserver-qpsmtpdrevert ability to disable login on qpsmtpd or sqpsmtpd with imap as it was with cvm
12434SME Server 10.X10.1smeserver-qpsmtpdupdating perl-Net-DNS-1.07-1.of.el7.noarch prevents qpsmtpd from accepting email until restart of the service
12431SME Server 10.X10.1e-smith-basegroup deletion leaves mail spool file with old uid, preventing further user creation /deletion
12421SME Server 10.X10.1e-smith-basesystemd-preset wrong path for etc
12417SME Server 10.X10.1smeserver-mysqlmysqld Error: Out of resources when opening file
12405SME Server 10.X10.1smeserver-phpNeed to add PHP 8.3 to smeserver-php
12403SME Server 10.X10.1smeserver-phpNeed to add PHP 8.2 and 8.3 to smeserver-php
12399SME Server 10.X10.1smeserver-dovecotmake dovecot and imap essential and always enabled
12398SME Server 10.X10.1smeserver-qpsmtpdqpsmtpd auth fails when imap is disabled
12395SME Server 10.X10.1smeserver-qpsmtpdSMTP password fails if it includes double quotes (at the end or possibly anywhere).
12393SME Server 10.X10.1smeserver-dovecotremove obsoletes words
12386SME Server 10.X10.1perl-QuotaUpdate perl-Quota to current release
12378SME Server 10.X10.1sambaThe trust relationship between this workstation and the primary domain failed
12357SME Server 10.X10.1e-smith-backupPDC domain users can't log in after migration
12335SME Server 10.X10.1e-smith-basesystem hangs after install and restore
12331SME Server 10.X10.1spamassassinUpgrade spamassassin to 4.0.0
12330SME Server 10.X10.1smeserver-spamassassinFix spamassassin 4.0.0 logging
12314SME Server 10.X10.1e-smith-ldapremove Alias=slapd.service
12304SME Server 10.X10.1e-smith-baseLogging stops to messages - imjournal: too many open files
12303SME Server 10.X10.1smeserver-phpphp_admin_value[session.save_handler] is set globally
12296SME Server 10.X10.1smeserver-hordemysl.init fails if php cli is set to higher version
12295SME Server 10.X10.1e-smith-baseDHCP config template should add in SME as backup for DNS servers, but does not
12287SME Server 10.X10.1e-smith-nutUPSnut-server not starting on boot when netserver mode enabled
12257SME Server 10.X10.1e-smith-baseDHCP Not working since last updates
12253SME Server 10.X10.1e-smith-basebootstrap-runlevel7.service screen displayed while no sysv service is misleading
Warnings were generated during the execution of function
  1. Report truncated - count greater than max allowed 101 > 100


Important.png Note:
The above fixed core packages will automatically be made available as regular updates through the updates repository. Before they become available as a regular update, the packages will be in the smetest repository for testing purposes.